These tools will no longer be maintained as of December 31, 2024. Archived website can be found here. PubMed4Hh GitHub repository can be found here. Contact NLM Customer Service if you have questions.


Pubmed for Handhelds

PUBMED FOR HANDHELDS

Search MEDLINE/PubMed

  • Title: Frog corticotropin-releasing hormone (CRH): isolation, molecular cloning, and biological activity.
    Author: Okada R, Ito Y, Kaneko M, Yamamoto K, Chartrel N, Conlon JM, Vaudry H, Kikuyama S.
    Journal: Ann N Y Acad Sci; 2005 Apr; 1040():150-5. PubMed ID: 15891019.
    Abstract:
    Corticotropin-releasing hormone (CRH) was isolated from the brain of the European green frog, Rana esculenta, by combining HPLC purification with radioimmunoassay (RIA) detection. The amino acid sequence SEEPPISLDLTFHLLREVLEMARAEQIAQQAHSNRKLMDII was identical with the sequence of bullfrog (R. catesbeiana) CRH that was deduced from a cDNA encoding the CRH precursor. Synthetic frog CRH enhanced the release of thyroid-stimulating hormone (TSH) from dispersed bullfrog pituitary cells in a concentration-dependent manner. The TSH-releasing activity of a bullfrog hypothalamic extract was decreased by approximately 45% in the presence of the CRH receptor antagonist, alpha-helical CRH(9-41), suggesting that CRH is one of the main TSH-releasing factors present in the bullfrog hypothalamus.
    [Abstract] [Full Text] [Related] [New Search]